PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03872g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 155aa    MW: 17266.6 Da    PI: 9.5751
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03872g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP72.91e-221579670
                       TCP  6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
                              +r+ ++h k + +dRR+Rl+ +ca r+F L+++LG+++ + tieWLl qa  ai ++   ++s+ 
  Niben101Scf03872g02001.1 15 TRTRDRHLKINRKDRRIRLPTSCAQRVFSLTEKLGHKTVGCTIEWLLVQADSAINAILAKKTSAL 79
                              79******************************************************999944433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.3E-231683IPR005333Transcription factor, TCP
PROSITE profilePS5136917.9891771IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDAPSPPPPG NRPSTRTRDR HLKINRKDRR IRLPTSCAQR VFSLTEKLGH KTVGCTIEWL  60
LVQADSAINA ILAKKTSALP SPQRLPPVVE NSIPTSTHRN RNVLPPFVFC HGLELGDMEF  120
SRDEIERFAS TNTSSESVGS SLPEQHMNVS NEKNC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616535.12e-89PREDICTED: transcription factor TCP9-like
SwissprotQ9C9L28e-18TCP15_ARATH; Transcription factor TCP15
TrEMBLA0A118JWU95e-17A0A118JWU9_CYNCS; Transcription factor, TCP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1567257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72010.13e-17TCP family protein